Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 proteins) silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain |
Protein automated matches [191258] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189817] (16 PDB entries) |
Domain d4y6qd_: 4y6q D: [310103] automated match to d1j8fc_ complexed with omr, zn |
PDB Entry: 4y6q (more details), 1.9 Å
SCOPe Domain Sequences for d4y6qd_:
Sequence, based on SEQRES records: (download)
>d4y6qd_ c.31.1.5 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} erlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlpyp eaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleri agleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivff geslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekaggggm dfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasida
>d4y6qd_ c.31.1.5 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} erlldeltlegvarymqsercrrviclvgagistsagipdfrspsteaifeisyfkkhpe pffalakelypgqfkptichyfmrllkdkglllrcytqnidtleriagleqedlveahgt fytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivffgeslparffscmqs dflkvdlllvmgtslqvqpfasliskaplstprllinkekagggmdfdskkayrdvawlg ecdqgclalaellgwkkeledlvrrehasida
Timeline for d4y6qd_: