Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.0: automated matches [191527] (1 protein) not a true family |
Protein automated matches [190890] (7 species) not a true protein |
Species Sedum alfredii [TaxId:439688] [311437] (1 PDB entry) |
Domain d4rvpf_: 4rvp F: [309604] automated match to d3mnda_ complexed with zn |
PDB Entry: 4rvp (more details), 2.6 Å
SCOPe Domain Sequences for d4rvpf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rvpf_ b.1.8.0 (F:) automated matches {Sedum alfredii [TaxId: 439688]} kkkavavlkgnsavegvvtltqeedgpttvnvritgltpgphgfhlhefgdttngcistg phfnpkglthgapedeirhagdlgnivanadgvaevtivdnqipltgpnavvgrafvvhe leddlgkgghelslstgnaggrlacgvigltpt
Timeline for d4rvpf_: