Lineage for d4rvpc_ (4rvp C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373677Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2374430Family b.1.8.0: automated matches [191527] (1 protein)
    not a true family
  6. 2374431Protein automated matches [190890] (7 species)
    not a true protein
  7. 2374455Species Sedum alfredii [TaxId:439688] [311437] (1 PDB entry)
  8. 2374458Domain d4rvpc_: 4rvp C: [309601]
    automated match to d3mnda_
    complexed with zn

Details for d4rvpc_

PDB Entry: 4rvp (more details), 2.6 Å

PDB Description: crystal structure of superoxide dismutase from sedum alfredii
PDB Compounds: (C:) superoxide dismutase

SCOPe Domain Sequences for d4rvpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rvpc_ b.1.8.0 (C:) automated matches {Sedum alfredii [TaxId: 439688]}
kkkavavlkgnsavegvvtltqeedgpttvnvritgltpgphgfhlhefgdttngcistg
phfnpkglthgapedeirhagdlgnivanadgvaevtivdnqipltgpnavvgrafvvhe
leddlgkgghelslstgnaggrlacgvigltpt

SCOPe Domain Coordinates for d4rvpc_:

Click to download the PDB-style file with coordinates for d4rvpc_.
(The format of our PDB-style files is described here.)

Timeline for d4rvpc_: