Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (87 species) not a true protein |
Species Streptomyces argillaceus [TaxId:41951] [311436] (5 PDB entries) |
Domain d4rvha1: 4rvh A:6-420 [309597] Other proteins in same PDB: d4rvha2 automated match to d3ndja_ complexed with 3yn, sah, zn |
PDB Entry: 4rvh (more details), 2.4 Å
SCOPe Domain Sequences for d4rvha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rvha1 c.66.1.0 (A:6-420) automated matches {Streptomyces argillaceus [TaxId: 41951]} taravttcrmcgaqdwqevvdfgpvpladsflepaasyddepryplavvscrscrlmslt hvvdpevlyrtypyttsdsetikkhmghvvavcverfgipegsfvleigsntgsqlkafq nagmrtlgidparniaavanergietlpeffsvdtaalvkkthgtpqlvlgrhvfahidd vsavaegvrdllgpdslfaievpylvdmlernefdtiyhehlsyigvgslvalfrrhglr vvdverlavhggsilvfvgldegtratapvveelialekerglyedatyerfarhvaeit aeltsmvrslraegkriagygapakgntllnvcgltaddlefccdttefkqglvlpgthi pvrspeyaktqaidyylllawnygeeilakegpfladggrfilpnprpsivppge
Timeline for d4rvha1: