Lineage for d4rvha1 (4rvh A:6-420)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2895034Species Streptomyces argillaceus [TaxId:41951] [311436] (5 PDB entries)
  8. 2895038Domain d4rvha1: 4rvh A:6-420 [309597]
    Other proteins in same PDB: d4rvha2
    automated match to d3ndja_
    complexed with 3yn, sah, zn

Details for d4rvha1

PDB Entry: 4rvh (more details), 2.4 Å

PDB Description: crystal structure of mtmc in complex with sah and tdp-4-keto-d-olivose
PDB Compounds: (A:) D-mycarose 3-C-methyltransferase

SCOPe Domain Sequences for d4rvha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rvha1 c.66.1.0 (A:6-420) automated matches {Streptomyces argillaceus [TaxId: 41951]}
taravttcrmcgaqdwqevvdfgpvpladsflepaasyddepryplavvscrscrlmslt
hvvdpevlyrtypyttsdsetikkhmghvvavcverfgipegsfvleigsntgsqlkafq
nagmrtlgidparniaavanergietlpeffsvdtaalvkkthgtpqlvlgrhvfahidd
vsavaegvrdllgpdslfaievpylvdmlernefdtiyhehlsyigvgslvalfrrhglr
vvdverlavhggsilvfvgldegtratapvveelialekerglyedatyerfarhvaeit
aeltsmvrslraegkriagygapakgntllnvcgltaddlefccdttefkqglvlpgthi
pvrspeyaktqaidyylllawnygeeilakegpfladggrfilpnprpsivppge

SCOPe Domain Coordinates for d4rvha1:

Click to download the PDB-style file with coordinates for d4rvha1.
(The format of our PDB-style files is described here.)

Timeline for d4rvha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rvha2