Lineage for d4rija2 (4rij A:245-606)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2160696Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2160697Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2160825Family c.91.1.0: automated matches [196141] (1 protein)
    not a true family
  6. 2160826Protein automated matches [196142] (6 species)
    not a true protein
  7. 2160860Species Mycobacterium tuberculosis [TaxId:83332] [271220] (3 PDB entries)
  8. 2160862Domain d4rija2: 4rij A:245-606 [309457]
    Other proteins in same PDB: d4rija1
    automated match to d4wpta2
    complexed with gdp, gol, mn, po4, zn

Details for d4rija2

PDB Entry: 4rij (more details), 2.12 Å

PDB Description: crystal structure of the mtb phosphoenolpyruvate carboxykinase(pepck) in complex with gdp and metals
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d4rija2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rija2 c.91.1.0 (A:245-606) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
wlaehmlilklispenkayyfaaafpsacgktnlamlqptipgwraetlgddiawmrfgk
dgrlyavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweglegdpq
hlidwkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfggrrktt
vplvteardwqhgvfigatlgseqtaaaegkvgnvrrdpmamlpflgynvgdyfqhwinl
gkhadesklpkvffvnwfrrgddgrflwpgfgensrvlkwivdriehkaggattpigtvp
avedldldgldvdaadvaaalavdadewrqelplieewlqfvgeklptgvkdefdalker
lg

SCOPe Domain Coordinates for d4rija2:

Click to download the PDB-style file with coordinates for d4rija2.
(The format of our PDB-style files is described here.)

Timeline for d4rija2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rija1