![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.91: PEP carboxykinase-like [53794] (1 superfamily) contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side |
![]() | Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) ![]() |
![]() | Family c.91.1.0: automated matches [196141] (1 protein) not a true family |
![]() | Protein automated matches [196142] (6 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [271220] (3 PDB entries) |
![]() | Domain d4rija2: 4rij A:245-606 [309457] Other proteins in same PDB: d4rija1 automated match to d4wpta2 complexed with gdp, gol, mn, po4, zn |
PDB Entry: 4rij (more details), 2.12 Å
SCOPe Domain Sequences for d4rija2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rija2 c.91.1.0 (A:245-606) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} wlaehmlilklispenkayyfaaafpsacgktnlamlqptipgwraetlgddiawmrfgk dgrlyavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweglegdpq hlidwkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfggrrktt vplvteardwqhgvfigatlgseqtaaaegkvgnvrrdpmamlpflgynvgdyfqhwinl gkhadesklpkvffvnwfrrgddgrflwpgfgensrvlkwivdriehkaggattpigtvp avedldldgldvdaadvaaalavdadewrqelplieewlqfvgeklptgvkdefdalker lg
Timeline for d4rija2: