Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d4qwsu_: 4qws U: [308971] Other proteins in same PDB: d4qwsa_, d4qwsc_, d4qwse_, d4qwsi_, d4qwsj_, d4qwsk_, d4qwsl_, d4qwsn_, d4qwso_, d4qwsq_, d4qwss_, d4qwsw_, d4qwsx_, d4qwsy_, d4qwsz_ automated match to d1rypa_ complexed with 3bv, cl, mes, mg; mutant |
PDB Entry: 4qws (more details), 3 Å
SCOPe Domain Sequences for d4qwsu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qwsu_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae q
Timeline for d4qwsu_: