SCOPe 2.07: Domain d4qv7s_: 4qv7 S:

Lineage for d4qv7s_ (4qv7 S:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (242 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4qv7s_: 4qv7 S: [308369]
   Other proteins in same PDB: d4qv7a_, d4qv7b_, d4qv7c_, d4qv7f_, d4qv7h_, d4qv7i_, d4qv7j_, d4qv7l_, d4qv7m_, d4qv7n_, d4qv7o_, d4qv7p_, d4qv7q_, d4qv7t_, d4qv7v_, d4qv7w_, d4qv7x_, d4qv7z_
   automated match to d4g4sf_
   complexed with cl, mg; mutant

Details for d4qv7s_

PDB Entry: 4qv7, 2.6 Å

PDB Description: yCP beta5-A50V mutant

PDB Compounds: (S:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d4qv7s_:

Sequence; same for both SEQRES and ATOM records:

>d4qv7s_ d.153.1.4 (S:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

Timeline for d4qv7s_:

• d4qv7s_ first appeared in SCOPe 2.06
  
• d4qv7s_ appears in the current release, SCOPe 2.08