Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d4qv7q_: 4qv7 Q: [308368] Other proteins in same PDB: d4qv7a_, d4qv7b_, d4qv7d_, d4qv7e_, d4qv7f_, d4qv7g_, d4qv7h_, d4qv7i_, d4qv7j_, d4qv7k_, d4qv7l_, d4qv7m_, d4qv7n_, d4qv7o_, d4qv7p_, d4qv7r_, d4qv7s_, d4qv7t_, d4qv7u_, d4qv7v_, d4qv7w_, d4qv7x_, d4qv7y_, d4qv7z_ automated match to d4eu2a_ complexed with cl, mg; mutant |
PDB Entry: 4qv7 (more details), 2.6 Å
SCOPe Domain Sequences for d4qv7q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qv7q_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d4qv7q_: