SCOPe 2.07: Domain d4qv1v_: 4qv1 V:

Lineage for d4qv1v_ (4qv1 V:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qv1v_: 4qv1 V: [308252]
   Other proteins in same PDB: d4qv1a_, d4qv1c_, d4qv1d_, d4qv1e_, d4qv1g_, d4qv1i_, d4qv1j_, d4qv1k_, d4qv1l_, d4qv1n_, d4qv1o_, d4qv1q_, d4qv1r_, d4qv1s_, d4qv1u_, d4qv1w_, d4qv1x_, d4qv1y_, d4qv1z_
   automated match to d4r17h_
   complexed with cl, mg; mutant

Details for d4qv1v_

PDB Entry: 4qv1, 2.5 Å

PDB Description: yCP beta5-M45A mutant

PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4qv1v_:

Sequence; same for both SEQRES and ATOM records:

>d4qv1v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

Timeline for d4qv1v_:

• d4qv1v_ first appeared in SCOPe 2.06
  
• d4qv1v_ appears in the current release, SCOPe 2.08