Lineage for d4qv1q_ (4qv1 Q:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602194Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2602200Domain d4qv1q_: 4qv1 Q: [308248]
    Other proteins in same PDB: d4qv1a_, d4qv1b_, d4qv1d_, d4qv1e_, d4qv1f_, d4qv1g_, d4qv1h_, d4qv1i_, d4qv1j_, d4qv1k_, d4qv1l_, d4qv1m_, d4qv1n_, d4qv1o_, d4qv1p_, d4qv1r_, d4qv1s_, d4qv1t_, d4qv1u_, d4qv1v_, d4qv1w_, d4qv1x_, d4qv1y_, d4qv1z_
    automated match to d4eu2a_
    complexed with cl, mg; mutant

Details for d4qv1q_

PDB Entry: 4qv1 (more details), 2.5 Å

PDB Description: yCP beta5-M45A mutant
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qv1q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qv1q_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4qv1q_:

Click to download the PDB-style file with coordinates for d4qv1q_.
(The format of our PDB-style files is described here.)

Timeline for d4qv1q_: