Lineage for d1e0rb_ (1e0r B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1155496Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 1155656Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 1155827Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein)
  6. 1155828Protein Thermosome, A-domain [52035] (4 species)
  7. 1155868Species Thermoplasma acidophilum, beta chain [TaxId:2303] [100947] (3 PDB entries)
  8. 1155871Domain d1e0rb_: 1e0r B: [30824]
    apical domain only

Details for d1e0rb_

PDB Entry: 1e0r (more details), 2.8 Å

PDB Description: beta-apical domain of thermosome
PDB Compounds: (B:) thermosome

SCOPe Domain Sequences for d1e0rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0rb_ c.8.5.2 (B:) Thermosome, A-domain {Thermoplasma acidophilum, beta chain [TaxId: 2303]}
mngiivdkekvhpgmpdvvkdakialldapleikkpefdtnlriedpsmiqkflaqeenm
lremvdkiksvganvvitqkgiddmaqhylsragiyavrrvkksdmdklakatgasivst
ideisssdlgtaerveqvkvgedymtfvtgsknh

SCOPe Domain Coordinates for d1e0rb_:

Click to download the PDB-style file with coordinates for d1e0rb_.
(The format of our PDB-style files is described here.)

Timeline for d1e0rb_: