Lineage for d4quxu_ (4qux U:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2600115Domain d4quxu_: 4qux U: [308179]
    Other proteins in same PDB: d4quxa_, d4quxc_, d4quxe_, d4quxi_, d4quxj_, d4quxk_, d4quxl_, d4quxn_, d4quxo_, d4quxq_, d4quxs_, d4quxw_, d4quxx_, d4quxy_, d4quxz_
    automated match to d1rypa_
    complexed with mg; mutant

Details for d4quxu_

PDB Entry: 4qux (more details), 3 Å

PDB Description: yCP beta5-A49T-mutant
PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d4quxu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4quxu_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d4quxu_:

Click to download the PDB-style file with coordinates for d4quxu_.
(The format of our PDB-style files is described here.)

Timeline for d4quxu_: