Lineage for d4quxo_ (4qux O:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2594884Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2594900Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (242 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2595509Domain d4quxo_: 4qux O: [308174]
    Other proteins in same PDB: d4quxb_, d4quxc_, d4quxf_, d4quxg_, d4quxh_, d4quxm_, d4quxp_, d4quxq_, d4quxt_, d4quxu_, d4quxv_
    automated match to d1rypb_
    complexed with mg; mutant

Details for d4quxo_

PDB Entry: 4qux (more details), 3 Å

PDB Description: yCP beta5-A49T-mutant
PDB Compounds: (O:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d4quxo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4quxo_ d.153.1.4 (O:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrleal

SCOPe Domain Coordinates for d4quxo_:

Click to download the PDB-style file with coordinates for d4quxo_.
(The format of our PDB-style files is described here.)

Timeline for d4quxo_: