SCOPe 2.06: Domain d3shhb1: 3shh B:1-126

Lineage for d3shhb1 (3shh B:1-126)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [226505] (8 PDB entries)

8. Domain d3shhb1: 3shh B:1-126 [306500]
   Other proteins in same PDB: d3shha2, d3shha3, d3shhb2, d3shhb3
   automated match to d4hcha1
   complexed with gol, mg, na, peg, tla

Details for d3shhb1

PDB Entry: 3shh, 1.7 Å

PDB Description: Crystal structure of glucarate dehydratase from Agrobacterium tumefaciens complexed with magnesium and L-tartrate

PDB Compounds: (B:) glucarate dehydratase

SCOPe Domain Sequences for d3shhb1:

Sequence; same for both SEQRES and ATOM records:

>d3shhb1 d.54.1.0 (B:1-126) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
miitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrph
viekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpv
ykligg

Timeline for d3shhb1:

• d3shhb1 is new in SCOPe 2.06-stable
  
• d3shhb1 appears in SCOPe 2.07
  
• d3shhb1 appears in the current release, SCOPe 2.08