Lineage for d1h7xd4 (1h7x D:184-287,D:441-532)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67446Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
  4. 67447Superfamily c.4.1: Nucleotide-binding domain [51971] (2 families) (S)
  5. 67448Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (3 proteins)
  6. 67458Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species)
  7. 67459Species Pig (Sus scrofa) [TaxId:9823] [51978] (2 PDB entries)
  8. 67467Domain d1h7xd4: 1h7x D:184-287,D:441-532 [30616]
    Other proteins in same PDB: d1h7xa1, d1h7xa2, d1h7xa3, d1h7xa5, d1h7xb1, d1h7xb2, d1h7xb3, d1h7xb5, d1h7xc1, d1h7xc2, d1h7xc3, d1h7xc5, d1h7xd1, d1h7xd2, d1h7xd3, d1h7xd5

Details for d1h7xd4

PDB Entry: 1h7x (more details), 2.01 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex of a mutant enzyme (c671a), nadph and 5-fluorouracil

SCOP Domain Sequences for d1h7xd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7xd4 c.4.1.1 (D:184-287,D:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa)}
eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf
eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik
fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv
sakpelplfytpvdlvd

SCOP Domain Coordinates for d1h7xd4:

Click to download the PDB-style file with coordinates for d1h7xd4.
(The format of our PDB-style files is described here.)

Timeline for d1h7xd4: