Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains |
Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (4 proteins) |
Protein Adrenodoxin reductase of mitochondrial p450 systems [51975] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [51976] (6 PDB entries) |
Domain d1e1ka2: 1e1k A:6-106,A:332-460 [30606] Other proteins in same PDB: d1e1ka1 complexed with fad, nap |
PDB Entry: 1e1k (more details), 1.95 Å
SCOP Domain Sequences for d1e1ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e1ka2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus)} tpqicvvgsgpagfytaqhllkhhsrahvdiyekqlvpfglvrfgvapdhpevknvintf tqtarsdrcafygnvevgrdvtvqelqdayhavvlsygaedXksrpidpsvpfdpklgvv pnmegrvvdvpglycsgwvkrgptgvitttmtdsfltgqillqdlkaghlpsgprpgsaf ikalldsrgvwpvsfsdwekldaeevsrgqasgkpreklldpqemlrllgh
Timeline for d1e1ka2: