![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) |
![]() | Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) ![]() |
![]() | Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (4 proteins) |
![]() | Protein Adrenodoxin reductase of mitochondrial p450 systems [51975] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [51976] (6 PDB entries) |
![]() | Domain d1cjca2: 1cjc A:6-106,A:332-460 [30604] Other proteins in same PDB: d1cjca1 |
PDB Entry: 1cjc (more details), 1.7 Å
SCOP Domain Sequences for d1cjca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus)} tpqicvvgsgpagfytaqhllkhhsrahvdiyekqlvpfglvrfgvapdhpevknvintf tqtarsdrcafygnvevgrdvtvqelqdayhavvlsygaedXksrpidpsvpfdpklgvv pnmegrvvdvpglycsgwvkrgptgvitttmtdsfltgqillqdlkaghlpsgprpgsaf ikalldsrgvwpvsfsdwekldaeevsrgqasgkpreklldpqemlrllgh
Timeline for d1cjca2: