Lineage for d1cjca2 (1cjc A:6-106,A:332-460)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) Superfamily c.4.1: Nucleotide-binding domain [51971] (2 families) 
Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (3 proteins) Protein Adrenodoxin reductase of mitochondrial p450 systems [51975] (1 species) Species Cow (Bos taurus) [TaxId:9913] [51976] (5 PDB entries) 
Domain d1cjca2: 1cjc A:6-106,A:332-460 [30604]
Other proteins in same PDB: d1cjca1
Details for d1cjca2
PDB Entry: 1cjc (more details), 1.7 Å
PDB Description: structure of adrenodoxin reductase of mitochondrial p450 systems
SCOP Domain Sequences for d1cjca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus)}
tpqicvvgsgpagfytaqhllkhhsrahvdiyekqlvpfglvrfgvapdhpevknvintf
tqtarsdrcafygnvevgrdvtvqelqdayhavvlsygaedXksrpidpsvpfdpklgvv
pnmegrvvdvpglycsgwvkrgptgvitttmtdsfltgqillqdlkaghlpsgprpgsaf
ikalldsrgvwpvsfsdwekldaeevsrgqasgkpreklldpqemlrllgh
SCOP Domain Coordinates for d1cjca2:
Click to download the PDB-style file with coordinates for d1cjca2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cjca2:
- d1cjca2 appears in SCOP 1.57
- d1cjca2 appears in the current release, SCOPe 2.08
View in 3D
