SCOPe 2.06: Domain d3lh6b_: 3lh6 B:

Lineage for d3lh6b_ (3lh6 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.7: YfcE-like [111233] (5 proteins)

6. Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [143936] (5 PDB entries)
   Uniprot Q9QZ88 1-182

8. Domain d3lh6b_: 3lh6 B: [305815]
   automated match to d2a22b_
   complexed with zn

Details for d3lh6b_

PDB Entry: 3lh6, 3 Å

PDB Description: Crystal structure of mouse VPS29 complexed with Zn2+

PDB Compounds: (B:) Vacuolar protein sorting-associated protein 29

SCOPe Domain Sequences for d3lh6b_:

Sequence; same for both SEQRES and ATOM records:

>d3lh6b_ d.159.1.7 (B:) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]}
mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
ks

Timeline for d3lh6b_:

• d3lh6b_ is new in SCOPe 2.06-stable
  
• d3lh6b_ appears in SCOPe 2.07
  
• d3lh6b_ appears in the current release, SCOPe 2.08