Lineage for d3k4db1 (3k4d B:1-181)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384843Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries)
  8. 2384878Domain d3k4db1: 3k4d B:1-181 [305669]
    Other proteins in same PDB: d3k4da2, d3k4da3, d3k4da4, d3k4db2, d3k4db3, d3k4db4
    automated match to d5czkb1
    complexed with eva

Details for d3k4db1

PDB Entry: 3k4d (more details), 2.39 Å

PDB Description: crystal structure of e. coli beta-glucuronidase with the glucaro-d- lactam inhibitor bound
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d3k4db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k4db1 b.18.1.0 (B:1-181) automated matches {Escherichia coli [TaxId: 83333]}
mlrpvetptreikkldglwafsldrencgidqrwwesalqesraiavpgsfndqfadadi
rnyagnvwyqrevfipkgwagqrivlrfdavthygkvwvnnqevmehqggytpfeadvtp
yviagksvritvcvnnelnwqtippgmvitdengkkkqsyfhdffnyagihrsvmlyttp
n

SCOPe Domain Coordinates for d3k4db1:

Click to download the PDB-style file with coordinates for d3k4db1.
(The format of our PDB-style files is described here.)

Timeline for d3k4db1: