Class b: All beta proteins [48724] (178 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (49 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries) |
Domain d3k4da1: 3k4d A:1-181 [305665] Other proteins in same PDB: d3k4da2, d3k4da3, d3k4da4, d3k4db2, d3k4db3, d3k4db4 automated match to d5czkb1 complexed with eva |
PDB Entry: 3k4d (more details), 2.39 Å
SCOPe Domain Sequences for d3k4da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k4da1 b.18.1.0 (A:1-181) automated matches {Escherichia coli [TaxId: 83333]} mlrpvetptreikkldglwafsldrencgidqrwwesalqesraiavpgsfndqfadadi rnyagnvwyqrevfipkgwagqrivlrfdavthygkvwvnnqevmehqggytpfeadvtp yviagksvritvcvnnelnwqtippgmvitdengkkkqsyfhdffnyagihrsvmlyttp n
Timeline for d3k4da1:
View in 3D Domains from other chains: (mouse over for more information) d3k4db1, d3k4db2, d3k4db3, d3k4db4 |