Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein NADH peroxidase [51955] (1 species) |
Species Enterococcus faecalis [TaxId:1351] [51956] (8 PDB entries) |
Domain d1f8wa2: 1f8w A:120-242 [30562] Other proteins in same PDB: d1f8wa3 complexed with fad; mutant |
PDB Entry: 1f8w (more details), 2.45 Å
SCOPe Domain Sequences for d1f8wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f8wa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} ipgkdldniylmrgrqwaiklkqktvdpevnnvvvigsgyigieaaeafakagkkvtvid ildrplgvyldkeftdvlteemeannitiatgetveryegdgrvqkvvtdknaydadlvv vav
Timeline for d1f8wa2: