SCOPe 2.05: Domain d1f8wa1: 1f8w A:1-119,A:243-321

Lineage for d1f8wa1 (1f8w A:1-119,A:243-321)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein NADH peroxidase [51955] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [51956] (8 PDB entries)

8. Domain d1f8wa1: 1f8w A:1-119,A:243-321 [30561]
   Other proteins in same PDB: d1f8wa3
   complexed with fad; mutant

Details for d1f8wa1

PDB Entry: 1f8w, 2.45 Å

PDB Description: crystal structure of nadh peroxidase mutant: r303m

PDB Compounds: (A:) nadh peroxidase

SCOPe Domain Sequences for d1f8wa1:

Sequence; same for both SEQRES and ATOM records:

>d1f8wa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}
mkvivlgsshggyeaveellnlhpdaeiqwyekgdfisflscgmqlylegkvkdvnsvry
mtgekmesrgvnvfsnteitaiqpkehqvtvkdlvsgeervenydkliispgavpfeldX
gvrpntawlkgtlelhpngliktdeymrtsepdvfavgdatlikynpadtevnialatna
mkqgrfavknleepvkpfp

Timeline for d1f8wa1:

• d1f8wa1 first appeared (with stable ids) in SCOP 1.55
  
• d1f8wa1 appears in SCOPe 2.04
  
• d1f8wa1 appears in SCOPe 2.06
  
• d1f8wa1 appears in the current release, SCOPe 2.08