Lineage for d2npxa1 (2npx A:1-119,A:243-321)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109341Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2109342Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2109874Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2110052Protein NADH peroxidase [51955] (1 species)
  7. 2110053Species Enterococcus faecalis [TaxId:1351] [51956] (8 PDB entries)
  8. 2110064Domain d2npxa1: 2npx A:1-119,A:243-321 [30559]
    Other proteins in same PDB: d2npxa3
    complexed with fad, nad

Details for d2npxa1

PDB Entry: 2npx (more details), 2.4 Å

PDB Description: nadh binding site and catalysis of nadh peroxidase
PDB Compounds: (A:) nadh peroxidase

SCOPe Domain Sequences for d2npxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2npxa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}
mkvivlgsshggyeaveellnlhpdaeiqwyekgdfisflscgmqlylegkvkdvnsvry
mtgekmesrgvnvfsnteitaiqpkehqvtvkdlvsgeervenydkliispgavpfeldX
gvrpntawlkgtlelhpngliktdeymrtsepdvfavgdatlikynpadtevnialatna
rkqgrfavknleepvkpfp

SCOPe Domain Coordinates for d2npxa1:

Click to download the PDB-style file with coordinates for d2npxa1.
(The format of our PDB-style files is described here.)

Timeline for d2npxa1: