Lineage for d1npx_2 (1npx 120-242)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 239501Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 239502Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 239750Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (12 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 239881Protein NADH peroxidase [51955] (1 species)
  7. 239882Species Enterococcus faecalis [TaxId:1351] [51956] (8 PDB entries)
  8. 239892Domain d1npx_2: 1npx 120-242 [30558]
    Other proteins in same PDB: d1npx_3
    complexed with cyo, fad

Details for d1npx_2

PDB Entry: 1npx (more details), 2.16 Å

PDB Description: structure of nadh peroxidase from streptococcus faecalis 10c1 refined at 2.16 angstroms resolution

SCOP Domain Sequences for d1npx_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1npx_2 c.3.1.5 (120-242) NADH peroxidase {Enterococcus faecalis}
ipgkdldniylmrgrqwaiklkqktvdpevnnvvvigsgyigieaaeafakagkkvtvid
ildrplgvyldkeftdvlteemeannitiatgetveryegdgrvqkvvtdknaydadlvv
vav

SCOP Domain Coordinates for d1npx_2:

Click to download the PDB-style file with coordinates for d1npx_2.
(The format of our PDB-style files is described here.)

Timeline for d1npx_2: