SCOPe 2.06: Domain d3eyxb_: 3eyx B:

Lineage for d3eyxb_ (3eyx B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families)

5. Family c.53.2.0: automated matches [191506] (1 protein)
   not a true family

6. Protein automated matches [190830] (9 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311286] (1 PDB entry)

8. Domain d3eyxb_: 3eyx B: [305336]
   automated match to d4rxya_
   complexed with act, edo, zn

Details for d3eyxb_

PDB Entry: 3eyx, 2.04 Å

PDB Description: Crystal structure of Carbonic Anhydrase Nce103 from Saccharomyces cerevisiae

PDB Compounds: (B:) carbonic anhydrase

SCOPe Domain Sequences for d3eyxb_:

Sequence, based on SEQRES records:

>d3eyxb_ c.53.2.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nlqdilaanakwasqmnniqptlfpdhnakgqsphtlfigcsdsrynenclgvlpgevft
wknvanichsedltlkatlefaiiclkvnkviicghtdcggiktcltnqrealpkvncsh
lykylddidtmyheesqnlihlktqrekshylshcnvkrqfnriienptvqtavqngelq
vygllynvedgllqtvstytkvtpk

Sequence, based on observed residues (ATOM records):

>d3eyxb_ c.53.2.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nlqdilaanakwasqmnniqptlfsphtlfigcsdsrynenclgvlpgevftwknvanic
hsedltlkatlefaiiclkvnkviicghtdcggiktcltnqrealpkvncshlykylddi
dtmyheesqnlihlktqrekshylshcnvkrqfnriienptvqtavqngelqvygllynv
edgllqtvstytkvtpk

Timeline for d3eyxb_:

• d3eyxb_ is new in SCOPe 2.06-stable
  
• d3eyxb_ appears in SCOPe 2.07
  
• d3eyxb_ appears in the current release, SCOPe 2.08