Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein Glutathione reductase, N- and C-terminal domain [418942] (3 species) |
Species Escherichia coli [TaxId:562] [419394] (4 PDB entries) |
Domain d1gerb1: 1ger B:2-146,B:263-335 [30479] Other proteins in same PDB: d1gera2, d1gera3, d1gerb2, d1gerb3 complexed with fad has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ger (more details), 1.86 Å
SCOPe Domain Sequences for d1gerb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gerb1 c.3.1.5 (B:2-146,B:263-335) Glutathione reductase, N- and C-terminal domain {Escherichia coli [TaxId: 562]} tkhydyiaigggsggiasinraamygqkcalieakelggtcvnvgcvpkkvmwhaaqire aihmygpdygfdttinkfnwetliasrtayidrihtsyenvlgknnvdvikgfarfvdak tlevngetitadhiliatggrpshpXrepandninleaagvktnekgyivvdkyqntnie giyavgdntgaveltpvavaagrrlserlfnnkpdehld
Timeline for d1gerb1: