Lineage for d2qhgf_ (2qhg F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346343Protein automated matches [190139] (27 species)
    not a true protein
  7. 2346528Species Saw-scaled viper (Echis carinatus) [TaxId:40353] [188231] (4 PDB entries)
  8. 2346534Domain d2qhgf_: 2qhg F: [304415]
    automated match to d2qhea_
    complexed with svr

Details for d2qhgf_

PDB Entry: 2qhg (more details), 2.3 Å

PDB Description: Crystal structure of ecarpholin S (Ser49-PLA2) complexed with suramin
PDB Compounds: (F:) phospholipase a2

SCOPe Domain Sequences for d2qhgf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qhgf_ a.133.1.2 (F:) automated matches {Saw-scaled viper (Echis carinatus) [TaxId: 40353]}
svvelgkmiiqetgkspfpsytsygcfcgggergppldatdrcclahsccydtlpdcspk
tdrykykrengeiicenstsckkricecdkavavclrknlntynkkytyypnfwckgdie
kc

SCOPe Domain Coordinates for d2qhgf_:

Click to download the PDB-style file with coordinates for d2qhgf_.
(The format of our PDB-style files is described here.)

Timeline for d2qhgf_: