Class a: All alpha proteins [46456] (289 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein automated matches [190139] (27 species) not a true protein |
Species Saw-scaled viper (Echis carinatus) [TaxId:40353] [188231] (4 PDB entries) |
Domain d2qhgd_: 2qhg D: [304413] automated match to d2qhea_ complexed with svr |
PDB Entry: 2qhg (more details), 2.3 Å
SCOPe Domain Sequences for d2qhgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qhgd_ a.133.1.2 (D:) automated matches {Saw-scaled viper (Echis carinatus) [TaxId: 40353]} svvelgkmiiqetgkspfpsytsygcfcgggergppldatdrcclahsccydtlpdcspk tdrykykrengeiicenstsckkricecdkavavclrknlntynkkytyypnfwckgdie kc
Timeline for d2qhgd_: