SCOPe 2.08: Domain d2phja_: 2phj A:

Lineage for d2phja_ (2phj A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.106: SurE-like [64166] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7

4. Superfamily c.106.1: SurE-like [64167] (2 families)
   some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family

5. Family c.106.1.0: automated matches [191430] (1 protein)
   not a true family

6. Protein automated matches [190619] (7 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [189062] (2 PDB entries)

8. Domain d2phja_: 2phj A: [304344]
   automated match to d2wqka_
   complexed with na, so4

Details for d2phja_

PDB Entry: 2phj, 1.5 Å

PDB Description: Crystal structure of SurE protein from Aquifex aeolicus

PDB Compounds: (A:) 5'-nucleotidase sure

SCOPe Domain Sequences for d2phja_:

Sequence; same for both SEQRES and ATOM records:

>d2phja_ c.106.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
ptfllvnddgyfspginalrealkslgrvvvvapdrnlsgvghsltfteplkmrkidtdf
ytvidgtpadcvhlgyrvileekkpdlvlsginegpnlgeditysgtvsgamegrilgip
siafsafgrenimfeeiakvcvdivkkvlnegipedtylnvnipnlryeeikgikvtrqg
kraykervfkyidpygkpfywiaaeefgwhaeegtdywavlngyvsvtplhldltnykvm
ksikyled

Timeline for d2phja_:

• d2phja_ first appeared in SCOPe 2.06
  
• d2phja_ appears in SCOPe 2.07