Lineage for d2o9mg_ (2o9m G:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207295Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2207296Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2207860Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 2207861Protein automated matches [227009] (13 species)
    not a true protein
  7. 2207934Species Escherichia coli [311232] (2 PDB entries)
  8. 2207942Domain d2o9mg_: 2o9m G: [304270]
    automated match to d3o1kb_
    complexed with ph2

Details for d2o9mg_

PDB Entry: 2o9m (more details), 2.45 Å

PDB Description: Crystal structure of E.coli dihydroneopterin aldolase in complex with 6-hydroxymethyl-7,8-dihydropterin
PDB Compounds: (G:) dihydroneopterin aldolase

SCOPe Domain Sequences for d2o9mg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o9mg_ d.96.1.0 (G:) automated matches {Escherichia coli}
mdivfieqlsvittigvydweqtieqklvfdiemawdnrkaaksddvadclsyadiaetv
vshvegarfalvervaeevaelllarfnspwvriklskpgavaraanvgviiergnnl

SCOPe Domain Coordinates for d2o9mg_:

Click to download the PDB-style file with coordinates for d2o9mg_.
(The format of our PDB-style files is described here.)

Timeline for d2o9mg_: