Lineage for d2nzgi_ (2nzg I:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2397831Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2398373Protein automated matches [190381] (11 species)
    not a true protein
  7. 2398561Species Vibrio cholerae [TaxId:666] [311230] (2 PDB entries)
  8. 2398567Domain d2nzgi_: 2nzg I: [304247]
    automated match to d1djrd_

Details for d2nzgi_

PDB Entry: 2nzg (more details), 1.94 Å

PDB Description: Novel binding site identified in a hybrid between cholera toxin and heat-labile enterotoxin, 1.9A crystal structure reveals the details
PDB Compounds: (I:) Cholera enterotoxin subunit B

SCOPe Domain Sequences for d2nzgi_:

Sequence, based on SEQRES records: (download)

>d2nzgi_ b.40.2.1 (I:) automated matches {Vibrio cholerae [TaxId: 666]}
apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisma

Sequence, based on observed residues (ATOM records): (download)

>d2nzgi_ b.40.2.1 (I:) automated matches {Vibrio cholerae [TaxId: 666]}
apqnitelcseyhntqiytindkilsyteslrgkremaiitfkngatfqvevpqkkaier
mkdtlriaylteakveklcvwnnktpnsiaaisma

SCOPe Domain Coordinates for d2nzgi_:

Click to download the PDB-style file with coordinates for d2nzgi_.
(The format of our PDB-style files is described here.)

Timeline for d2nzgi_: