SCOPe 2.07: Domain d2iq8a2: 2iq8 A:185-264

Lineage for d2iq8a2 (2iq8 A:185-264)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.3: Phenylalanine metabolism regulatory domain [55028] (2 proteins)

6. Protein Prephenate dehydratase C-terminal domain [160320] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [160321] (2 PDB entries)
   Uniprot Q99SX2 185-264

8. Domain d2iq8a2: 2iq8 A:185-264 [304079]
   Other proteins in same PDB: d2iq8a1, d2iq8b1
   automated match to d2qmwa2
   complexed with act, edo, mg, peg

Details for d2iq8a2

PDB Entry: 2iq8, 2.3 Å

PDB Description: The crystal structure of putative prephenate dehydratase from Staphylococcus aureus subsp. aureus Mu50

PDB Compounds: (A:) Putative prephenate dehydratase

SCOPe Domain Sequences for d2iq8a2:

Sequence; same for both SEQRES and ATOM records:

>d2iq8a2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
slmflitpmhdkpgllasvlntfalfninlswiesrplktqlgmyrffvqadsaittdik
kviailetldfkvemigafn

Timeline for d2iq8a2:

• d2iq8a2 first appeared in SCOPe 2.06
  
• d2iq8a2 appears in the current release, SCOPe 2.08