Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein Prephenate dehydratase [159808] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [159809] (2 PDB entries) Uniprot Q99SX2 1-184 |
Domain d2iq8a1: 2iq8 A:1-184 [304078] Other proteins in same PDB: d2iq8a2, d2iq8b2 automated match to d2qmwa1 complexed with act, edo, mg, peg |
PDB Entry: 2iq8 (more details), 2.3 Å
SCOPe Domain Sequences for d2iq8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iq8a1 c.94.1.1 (A:1-184) Prephenate dehydratase {Staphylococcus aureus [TaxId: 1280]} mqlyylgpkgtfsylacrqyfseneatfqpksnlfevikavadddtsigvvpiensiegt inivadalaqqdvfahgeirldinfalygngtdsisdikkvysiapaisqttnyihqhqf dydyvdstiqsltkiengvaaiaplgsgeaygftpidthiedyphnvtrflviknqqqfd qnat
Timeline for d2iq8a1: