Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) |
Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins) C-terminal domain is alpha+beta is common for the family |
Protein Polyamine oxidase [51927] (1 species) |
Species Maize (Zea mays) [TaxId:4577] [51928] (7 PDB entries) |
Domain d1h82b1: 1h82 B:5-293,B:406-466 [30393] Other proteins in same PDB: d1h82a2, d1h82b2, d1h82c2 complexed with fad, gzz, nag |
PDB Entry: 1h82 (more details), 1.9 Å
SCOPe Domain Sequences for d1h82b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h82b1 c.3.1.2 (B:5-293,B:406-466) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} prvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganwvegv nggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsveemge klsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtslqntv platfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvreikysp ggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfXwpvgvnryey dqlrapvgrvyftgehtsehyngyvhgaylsgidsaeilincaqkkmckyh
Timeline for d1h82b1:
View in 3D Domains from other chains: (mouse over for more information) d1h82a1, d1h82a2, d1h82c1, d1h82c2 |