Lineage for d1h82b1 (1h82 B:5-293,B:406-466)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 978527Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 978528Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 978582Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 978802Protein Polyamine oxidase [51927] (1 species)
  7. 978803Species Maize (Zea mays) [TaxId:4577] [51928] (7 PDB entries)
  8. 978814Domain d1h82b1: 1h82 B:5-293,B:406-466 [30393]
    Other proteins in same PDB: d1h82a2, d1h82b2, d1h82c2
    complexed with fad, gzz, nag

Details for d1h82b1

PDB Entry: 1h82 (more details), 1.9 Å

PDB Description: structure of polyamine oxidase in complex with guazatine
PDB Compounds: (B:) polyamine oxidase

SCOPe Domain Sequences for d1h82b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h82b1 c.3.1.2 (B:5-293,B:406-466) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}
prvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganwvegv
nggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsveemge
klsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtslqntv
platfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvreikysp
ggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfXwpvgvnryey
dqlrapvgrvyftgehtsehyngyvhgaylsgidsaeilincaqkkmckyh

SCOPe Domain Coordinates for d1h82b1:

Click to download the PDB-style file with coordinates for d1h82b1.
(The format of our PDB-style files is described here.)

Timeline for d1h82b1: