Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins) |
Protein VH1-related dual-specificity phosphatase, VHR [52801] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52802] (4 PDB entries) |
Domain d2f4da_: 2f4d A: [303808] automated match to d1vhra_ complexed with bme, edo, hgt |
PDB Entry: 2f4d (more details), 1.67 Å
SCOPe Domain Sequences for d2f4da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f4da_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} elsvqdlndllsdgsgcyslpsqpcnevtpriyvgnasvaqdipklqklgithvlnaaeg rsfmhvntnanfykdsgitylgikandtqefnlsayferaadfidqalaqkngrvlvhcr egysrsptlviaylmmrqkmdvksalsivrqnreigpndgflaqlcqlndrlakegklkp
Timeline for d2f4da_: