Lineage for d2f4da_ (2f4d A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875107Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 2875158Protein VH1-related dual-specificity phosphatase, VHR [52801] (1 species)
  7. 2875159Species Human (Homo sapiens) [TaxId:9606] [52802] (4 PDB entries)
  8. 2875160Domain d2f4da_: 2f4d A: [303808]
    automated match to d1vhra_
    complexed with bme, edo, hgt

Details for d2f4da_

PDB Entry: 2f4d (more details), 1.67 Å

PDB Description: Crystal structure of the complex of VHR and its inhibitor GATH
PDB Compounds: (A:) dual specificity protein phosphatase 3

SCOPe Domain Sequences for d2f4da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4da_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]}
elsvqdlndllsdgsgcyslpsqpcnevtpriyvgnasvaqdipklqklgithvlnaaeg
rsfmhvntnanfykdsgitylgikandtqefnlsayferaadfidqalaqkngrvlvhcr
egysrsptlviaylmmrqkmdvksalsivrqnreigpndgflaqlcqlndrlakegklkp

SCOPe Domain Coordinates for d2f4da_:

Click to download the PDB-style file with coordinates for d2f4da_.
(The format of our PDB-style files is described here.)

Timeline for d2f4da_: