Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (26 species) not a true protein |
Species Fungia concinna [TaxId:496660] [193728] (8 PDB entries) |
Domain d2ejoa_: 2ejo A: [303784] automated match to d2zmua_ |
PDB Entry: 2ejo (more details), 1.65 Å
SCOPe Domain Sequences for d2ejoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ejoa_ d.22.1.0 (A:) automated matches {Fungia concinna [TaxId: 496660]} vsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvs hvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhks kftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyk aakkilkmpgshyishrlvrktegnitelvedavahs
Timeline for d2ejoa_: