Lineage for d1zpyh_ (1zpy H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317066Family a.25.1.5: half-ferritin [140450] (1 protein)
    comprise of alpha-hairpin subunits forming the ferritin-like four-helical bundle; assembles further in a homodecamer
  6. 2317067Protein Hypothetical protein NE0167 [140451] (1 species)
  7. 2317068Species Nitrosomonas europaea [TaxId:915] [140452] (2 PDB entries)
    Uniprot Q82XT5 4-94
  8. 2317076Domain d1zpyh_: 1zpy H: [303467]
    automated match to d3k6ca_

Details for d1zpyh_

PDB Entry: 1zpy (more details), 2.2 Å

PDB Description: Crystal structure of protein NE0167 from Nitrosomonas europaea
PDB Compounds: (H:) hypothetical protein NE0167

SCOPe Domain Sequences for d1zpyh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zpyh_ a.25.1.5 (H:) Hypothetical protein NE0167 {Nitrosomonas europaea [TaxId: 915]}
dgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdeekeh
aamllewirrcdpafdkelkdylftnkpiah

SCOPe Domain Coordinates for d1zpyh_:

Click to download the PDB-style file with coordinates for d1zpyh_.
(The format of our PDB-style files is described here.)

Timeline for d1zpyh_: