Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.5: half-ferritin [140450] (1 protein) comprise of alpha-hairpin subunits forming the ferritin-like four-helical bundle; assembles further in a homodecamer |
Protein Hypothetical protein NE0167 [140451] (1 species) |
Species Nitrosomonas europaea [TaxId:915] [140452] (2 PDB entries) Uniprot Q82XT5 4-94 |
Domain d1zpyd_: 1zpy D: [303463] automated match to d3k6ca_ |
PDB Entry: 1zpy (more details), 2.2 Å
SCOPe Domain Sequences for d1zpyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zpyd_ a.25.1.5 (D:) Hypothetical protein NE0167 {Nitrosomonas europaea [TaxId: 915]} dgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdeekeh aamllewirrcdpafdkelkdylftnkpiahe
Timeline for d1zpyd_: