Lineage for d1zgmb1 (1zgm B:3-87)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132062Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2132632Protein Hypothetical protein AGR_pAT_752p/Atu5508 [142361] (1 species)
    putative glutathione S-transferase
  7. 2132633Species Agrobacterium tumefaciens [TaxId:358] [142362] (2 PDB entries)
    Uniprot Q7D2W7 1-87
  8. 2132635Domain d1zgmb1: 1zgm B:3-87 [303456]
    Other proteins in same PDB: d1zgma2, d1zgma3, d1zgmb2
    automated match to d2fnoa2
    complexed with scn

Details for d1zgmb1

PDB Entry: 1zgm (more details), 1.9 Å

PDB Description: crystal structure of putative glutathione s-transferase (15162326) from agrobacterium tumefaciens at 2.25 a resolution
PDB Compounds: (B:) Putative glutathione S-transferase

SCOPe Domain Sequences for d1zgmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgmb1 c.47.1.5 (B:3-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]}
dgmntfdlyywpvpfrgqlirgilahcgcswdehdvdaieglmdcgaekqpvafmgppvl
idrernfaisqmpaiaiylgerldi

SCOPe Domain Coordinates for d1zgmb1:

Click to download the PDB-style file with coordinates for d1zgmb1.
(The format of our PDB-style files is described here.)

Timeline for d1zgmb1: