![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Azurin [49530] (6 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [49533] (90 PDB entries) Uniprot P00282 |
![]() | Domain d1tsbc_: 1tsb C: [303101] automated match to d2tsaa_ complexed with azi, cu; mutant |
PDB Entry: 1tsb (more details), 2.3 Å
SCOPe Domain Sequences for d1tsbc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tsbc_ b.6.1.1 (C:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal akgtltlk
Timeline for d1tsbc_: