Lineage for d1qlab4 (1qla B:107-239)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2689591Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2689592Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 2689593Protein Fumarate reductase [46550] (3 species)
  7. 2689610Species Wolinella succinogenes [TaxId:844] [46552] (5 PDB entries)
  8. 2689613Domain d1qlab4: 1qla B:107-239 [302946]
    Other proteins in same PDB: d1qlaa4, d1qlaa5, d1qlaa6, d1qlab3, d1qlac_, d1qlad4, d1qlad5, d1qlad6, d1qlae3, d1qlaf_
    automated match to d1qlbb1
    complexed with ca, f3s, fad, fes, hem, lmt, sf4

Details for d1qlab4

PDB Entry: 1qla (more details), 2.2 Å

PDB Description: respiratory complex ii-like fumarate reductase from wolinella succinogenes
PDB Compounds: (B:) fumarate reductase iron-sulfur protein

SCOPe Domain Sequences for d1qlab4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlab4 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim
redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs
kiaylrrkmvsvn

SCOPe Domain Coordinates for d1qlab4:

Click to download the PDB-style file with coordinates for d1qlab4.
(The format of our PDB-style files is described here.)

Timeline for d1qlab4: