SCOPe 2.06: Domain d1k87a3: 1k87 A:87-261

Lineage for d1k87a3 (1k87 A:87-261)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
   multihelical; array

4. Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families)

5. Family a.176.1.0: automated matches [227131] (1 protein)
   not a true family

6. Protein automated matches [226832] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [311154] (1 PDB entry)

8. Domain d1k87a3: 1k87 A:87-261 [302614]
   Other proteins in same PDB: d1k87a4
   automated match to d1tj2a1
   complexed with 1pe, fad, gol, lac, trs

Details for d1k87a3

PDB Entry: 1k87, 2 Å

PDB Description: Crystal structure of E.coli PutA (residues 1-669)

PDB Compounds: (A:) proline dehydrogenase

SCOPe Domain Sequences for d1k87a3:

Sequence, based on SEQRES records:

>d1k87a3 a.176.1.0 (A:87-261) automated matches {Escherichia coli [TaxId: 562]}
pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag
mvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfv
naatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records):

>d1k87a3 a.176.1.0 (A:87-261) automated matches {Escherichia coli [TaxId: 562]}
pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag
mvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnrspslfvnaatwg
llftgneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Timeline for d1k87a3:

• d1k87a3 is new in SCOPe 2.06-stable
  
• d1k87a3 appears in SCOPe 2.07
  
• d1k87a3 appears in the current release, SCOPe 2.08