SCOPe 2.06: Domain d1du7a3: 1du7 A:2-67

Lineage for d1du7a3 (1du7 A:2-67)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (27 PDB entries)

8. Domain d1du7a3: 1du7 A:2-67 [302352]
   Other proteins in same PDB: d1du7a4
   automated match to d1bjza1
   protein/DNA complex; complexed with ctc

Details for d1du7a3

PDB Entry: 1du7, 2.51 Å

PDB Description: crystal structure of tet repressor class d with 4-epi-tetracycline

PDB Compounds: (A:) protein (tetracycline repressor protein class d)

SCOPe Domain Sequences for d1du7a3:

Sequence; same for both SEQRES and ATOM records:

>d1du7a3 a.4.1.9 (A:2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

Timeline for d1du7a3:

• d1du7a3 is new in SCOPe 2.06-stable
  
• d1du7a3 appears in SCOPe 2.07
  
• d1du7a3 appears in the current release, SCOPe 2.08