Lineage for d1dkva6 (1dkv A:514-700)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2324762Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2324763Protein automated matches [190513] (36 species)
    not a true protein
  7. 2324820Species Human (Homo sapiens) [TaxId:9606] [189519] (56 PDB entries)
  8. 2324851Domain d1dkva6: 1dkv A:514-700 [302340]
    Other proteins in same PDB: d1dkva4, d1dkva5, d1dkvb_
    automated match to d1qxpa2

Details for d1dkva6

PDB Entry: 1dkv (more details), 2.3 Å

PDB Description: the crystal structure of calcium-free human m-calpain
PDB Compounds: (A:) m-calpain

SCOPe Domain Sequences for d1dkva6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkva6 a.39.1.0 (A:514-700) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deieanleefdiseddiddgvrrlfaqlagedaeisafelqtilrrvlakrqdiksdgfs
ietckimvdmldsdgsgklglkefyilwtkiqkyqkiyreidvdrsgtmnsyemrkalee
agfkmpcqlhqvivarfaddqliidfdnfvrclvrletlfkifkqldpentgtieldlis
wlcfsvl

SCOPe Domain Coordinates for d1dkva6:

Click to download the PDB-style file with coordinates for d1dkva6.
(The format of our PDB-style files is described here.)

Timeline for d1dkva6:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dkvb_