![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (87 species) not a true protein |
![]() | Species Escherichia coli [311127] (3 PDB entries) |
![]() | Domain d1db8a4: 1db8 A:138-207 [302315] Other proteins in same PDB: d1db8a3 automated match to d4i02a2 protein/DNA complex; complexed with cmp |
PDB Entry: 1db8 (more details), 3 Å
SCOPe Domain Sequences for d1db8a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1db8a4 a.4.5.0 (A:138-207) automated matches {Escherichia coli} dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis ahgktivvyg
Timeline for d1db8a4: