PDB entry 1db8

View 1db8 on RCSB PDB site
Description: protein-DNA recognition and DNA deformation revealed in crystal structures of cap-DNA complexes
Class: gene regulation/DNA
Keywords: protein-DNA complex, cap, cap-DNA, catabolite gene activator protein, camp receptor protein, crp
Deposited on 1999-11-02, released 2001-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-04-08, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.231
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: catabolite gene activator protein
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03020 (0-199)
  Domains in SCOPe 2.07: d1db8a3, d1db8a4
• Chain 'B':
  Compound: 5'-d(*ap*ap*ap*ap*ap*tp*gp*cp*gp*ap*t)-3'
  
• Chain 'C':
  Compound: 5'-d(*cp*tp*ap*gp*ap*tp*cp*gp*cp*ap*tp*tp*tp*tp*t)-3'
  
• Heterogens: CMP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1db8A (A:)
  dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
  dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
  sekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgril
  kmledqnlisahgktivvyg
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.