Lineage for d1ldnd1 (1ldn D:15-162)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2105555Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2105594Protein Lactate dehydrogenase [51859] (18 species)
  7. 2105595Species Bacillus stearothermophilus [TaxId:1422] [51864] (3 PDB entries)
  8. 2105599Domain d1ldnd1: 1ldn D:15-162 [30169]
    Other proteins in same PDB: d1ldna2, d1ldnb2, d1ldnc2, d1ldnd2, d1ldne2, d1ldnf2, d1ldng2, d1ldnh2
    complexed with fbp, nad, oxm

Details for d1ldnd1

PDB Entry: 1ldn (more details), 2.5 Å

PDB Description: structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution
PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1ldnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldnd1 c.2.1.5 (D:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
vatnpvdiltyatwkfsglphervigsg

SCOPe Domain Coordinates for d1ldnd1:

Click to download the PDB-style file with coordinates for d1ldnd1.
(The format of our PDB-style files is described here.)

Timeline for d1ldnd1: