SCOPe 2.07: Domain d4uz3b2: 4uz3 B:63-110

Lineage for d4uz3b2 (4uz3 B:63-110)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.7: LysM domain [54105] (1 superfamily)
   beta-alpha(2)-beta; antiparallel strands

4. Superfamily d.7.1: LysM domain [54106] (2 families)
   automatically mapped to Pfam PF01476

5. Family d.7.1.0: automated matches [234000] (1 protein)
   not a true family

6. Protein automated matches [234001] (6 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [268982] (2 PDB entries)

8. Domain d4uz3b2: 4uz3 B:63-110 [301047]
   automated match to d4uz3c_
   complexed with dio, so4

Details for d4uz3b2

PDB Entry: 4uz3, 1.75 Å

PDB Description: crystal structure of the n-terminal lysm domains from the putative nlpc/p60 d,l endopeptidase from t. thermophilus bound to n-acetyl- chitohexaose

PDB Compounds: (B:) cell wall-binding endopeptidase-related protein

SCOPe Domain Sequences for d4uz3b2:

Sequence; same for both SEQRES and ATOM records:

>d4uz3b2 d.7.1.0 (B:63-110) automated matches {Thermus thermophilus [TaxId: 300852]}
rerthvvapgdtlfslarrygttvealmrlnglsspeikvgqvlrlpe

Timeline for d4uz3b2:

• d4uz3b2 first appeared in SCOPe 2.06
  
• d4uz3b2 appears in the current release, SCOPe 2.08