Lineage for d4uz3b1 (4uz3 B:17-62)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535978Fold d.7: LysM domain [54105] (1 superfamily)
    beta-alpha(2)-beta; antiparallel strands
  4. 2535979Superfamily d.7.1: LysM domain [54106] (2 families) (S)
    automatically mapped to Pfam PF01476
  5. 2535988Family d.7.1.0: automated matches [234000] (1 protein)
    not a true family
  6. 2535989Protein automated matches [234001] (6 species)
    not a true protein
  7. 2536017Species Thermus thermophilus [TaxId:300852] [268982] (2 PDB entries)
  8. 2536020Domain d4uz3b1: 4uz3 B:17-62 [301046]
    automated match to d4uz3c_
    complexed with dio, so4

Details for d4uz3b1

PDB Entry: 4uz3 (more details), 1.75 Å

PDB Description: crystal structure of the n-terminal lysm domains from the putative nlpc/p60 d,l endopeptidase from t. thermophilus bound to n-acetyl- chitohexaose
PDB Compounds: (B:) cell wall-binding endopeptidase-related protein

SCOPe Domain Sequences for d4uz3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uz3b1 d.7.1.0 (B:17-62) automated matches {Thermus thermophilus [TaxId: 300852]}
atytvapgdtlysiarrygttveelmrlnglesfllqpgqvlklps

SCOPe Domain Coordinates for d4uz3b1:

Click to download the PDB-style file with coordinates for d4uz3b1.
(The format of our PDB-style files is described here.)

Timeline for d4uz3b1: